Total number of results for Myoxocephalus scorpius are 4
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02369 |
LQDAEDSSRFDADDTLAGEARELSTP
|
26 | Myoxocephalus scorpius | Glucagon | Glicentin-related polypeptide | 3549298#Conlon J.M., Falkmer S., Thim L.#Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).# Eur. J. Biochem. 164:117-122(1987). | |
| NP02370 |
HSEGTFSNDYSKYLETRRAQDFVQWLKNS
|
29 | Myoxocephalus scorpius | Glucagon | Glucagon | 3549298#Conlon J.M., Falkmer S., Thim L.#Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).# Eur. J. Biochem. 164:117-122(1987). | |
| NP02371 |
HADGTFTSDVSSYLNDQAIKDFVAKLKSGKV
|
31 | Myoxocephalus scorpius | Glucagon | Glucagon-like peptide | 3549298#Conlon J.M., Falkmer S., Thim L.#Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).# Eur. J. Biochem. 164:117-122(1987). | |
| NP03929 |
YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRY
|
36 | Myoxocephalus scorpius | NPY | Pancreatic polypeptide | 3562898#Conlon JM, Schmidt WE, Gallwitz B, Falkmer S, Thim L#Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius)#Regul Pept 1986 Dec 30;16(3-4):261-8 $2883025#Cutfield S.M., Carne A., Cutfield J.F.#The amino-acid sequences of sculpin islet somatostatin-28 and peptide YY.#FEBS Lett. 214:57-61(1987). |